Product Details
| Description |
Full-length of mature human glutaminyl-peptide acyltransferase(QPCT) cDNA carrying an N-terminal 6xHis-SUMO-tag was expressed in E.coli. The resulting protein is the recombinant fusion protein consisting of 29-361aa of human QPCT. It was validated by LC-MS/MS analysis. The SDS-PAGE showed an about 47-51 kDa molecular mass of this protein and determined the purity of over 90%. In-stock QPCT proteins are offered now. This recombinant QPCT protein may be used to produce specific antibodies or in the studies of neuroscience. QPCT catalyzes the conversion of the N-terminal glutamate of proteins to pyroglutamate. This process makes the protein more resistant to protease degradation, more susceptible to hydrophobic interactions, aggregation, and neurotoxic. Ziyan Wang etc. demonstrated that QPCT knockdown led to the down-regulation of prophenoloxidase and crustin antimicrobial peptide. And QPCT may contribute to the replication of the White spot syndrome virus (WSSV). |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | QPCT |
| Research Area | Neuroscience |
| Alternative Names | 5730422A13Rik; EC; GCT; Glutaminyl cyclase; Glutaminyl peptide cyclotransferase; Glutaminyl tRNA cyclotransferase; Glutaminyl-peptide cyclotransferase; Glutaminyl-tRNA cyclotransferase; Glutamyl cyclase; QC; qpct; QPCT_HUMAN; sQC |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 29-361aa |
| Target Protein Sequence | VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 53.9kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |