Product Details
| Description |
A construct encoding NH2-terminally 6xHis-tagged human selenoprotein P (SEPP1) was expressed in the E.coli cells. The resulting protein is the recombinant full-length of mature SEPP1 protein containing amino acid sequence 20-381 of mouse SEPP1. The purity of this SEPP1 protein is greater than 90?termined by SDS-PAGE. A molecular mass band range from 40 kDa was presented on the SDS-PAGE gel under reducing conditions. In-stock SEPP1 proteins are offered now. In addition to being used to immunize animals for specific antibody synthesis, this recombinant SEPP1 protein may also find use int he studies of selenium-metabolism or SEPP1-related diseases. SEPP1 is a major selenium-containing protein in human plasma and is primarily expressed in the liver and secreted into the extracellular fluid. As a selenium-transporter, SEPP1 sustains antioxidative selenoenzymes in several tissues such as the brain and testis and plays an important role in selenium-metabolism and antioxidative defense. The...Read more
|
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | SELENOP |
| Research Area | Others |
| Alternative Names | Selenoprotein P; Selenoprotein P plasma 1; Selp; SeP; Sepp1; SEPP1_HUMAN |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 20-381aa(U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S) |
| Target Protein Sequence | ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 44.6kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info | N-terminal 6xHis-tagged |
| Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |

