Product Details
| Description |
E.coli-expressed recombinant human signal transducer and activator of transcription 3 (STAT3) contains 191 amino acids covering the partial-length of STAT3 protein (50-240aa). And it has its N-terminus fused with a 6xHis-SUMO-tag and a total molecular weight of 38.3 kDa. The purity of this human STAT3 protein is greater than 90% measured by SDS-PAGE. Its identity was validated by the LC-MS/MS analysis. This protein is in-stock, which means there is no waiting period for protein preparation. This recombinant STAT3 protein may find uses in the specific antibody synthesis or the studies of immunology. STAT3 transduces extracellular signals from cytokines such as IL6, Il8, and IL35 and regulates the expression of numerous genes crucial for immune responses and cell differentiation. STAT3 is also regarded as an early tumor diagnostic marker and is known to promote breast cancer malignancy. JAK–STAT3 signaling is critical for cancer development in both tumor cells and the tumor microenvironm...Read more
|
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | STAT3 |
| Research Area | Immunology |
| Alternative Names | 1110034C02Rik; Acute Phase Response Factor; Acute-phase response factor; ADMIO; APRF; AW109958; DNA binding protein APRF; FLJ20882; HIES; MGC16063; Signal transducer and activator of transcription 3 (acute phase response factor); Signal transducer and activator of transcription 3; STAT 3; Stat3; STAT3_HUMAN |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 50-240aa |
| Target Protein Sequence | ESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 38.3kDa |
| Protein Length | Partial |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |