18 years of successful growth

Recombinant Human Vesicle-associated membrane protein 2(VAMP2)

Product Details

Description

The N-terminal GST-tagged recombinant vesicle-associated membrane protein 2 (VAMP2) is produced by expressing the target gene fragment in E.coli and fusing the GST tag to the N-terminus of the resulting protein. The target gene sequence corresponds to the intact amino acids of the human VAMP2. Its purity is greater than 90?termined by SDS-PAGE. On the gel, this recombinant VAMP2 protein migrated to the molecular weight band of approximately 40 kDa. It has also been validated its component by the LC-MS/MS analysis. The target protein VAMP2 is involved in several biological processes, including the targeting or fusion of transport vesicles to their target membrane and the insulin-regulated trafficking of GLUT4 in adipocytes.

Purity Greater than 90% as determined by SDS-PAGE.
Target Names VAMP2
Research Area Cancer
Alternative Names FLJ11460; RATVAMPB; RATVAMPIR; SYB; SYB2; Synaptobrevin 2; Synaptobrevin-2; VAMP 2; VAMP-2; Vamp2; VAMP2_HUMAN; Vesicle associated membrane protein 2; Vesicle-associated membrane protein 2 (synaptobrevin 2); Vesicle-associated membrane protein 2
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-116aa
Target Protein Sequence MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 39.7kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer Tris-based buffer,50% glycerol
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.
Download X-Ray Brochures