Product Details
| Description |
Interleukin-2 receptor subunit beta/Il2rb CSB-EP011650MO1 is a recombinant partial-length protein containing the extracellular domain (24-240aa) of mouse Il2rb. This protein was fused with a 6xHis-tag at the N-terminus and expressed in E.coli. Its identity was validated by LC-MS/MS analysis. Its purity is greater than 90?termined by SDS-PAGE. A molecular weight band of about 30kDa was visualized on gel under reducing conditions. The recombinant Il2rb protein may find applications in specific antibody production and signal transduction associated with IL2rb. IL2rb, also called CD122, is the IL-2R β-chain, which is shared with IL-15R. Upon T-cell activation, IL-2Rα (CD25) is rapidly induced and help IL2rb and IL-2Rγc (CD132) come closer, constituting an intermediate affinity receptor that is sufficient to elicit the IL2 signaling pathways. signaling through IL2rb is indispensable for the differentiation and function of cells and NK cells. Xiaomei Yuan etc. demonstrated that IL2rb bloc...Read more
|
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | l2rb |
| Research Area | Others |
| Alternative Names | Il2rbInterleukin-2 receptor subunit beta; IL-2 receptor subunit beta; IL-2R subunit beta; IL-2RB; High affinity IL-2 receptor subunit beta; p70-75; CD antigen CD122 |
| Species | Mus musculus (Mouse) |
| Source | E.coli |
| Expression Region | 24-240aa |
| Target Protein Sequence | ASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 29.0kDa |
| Protein Length | Extracellular Domain |
| Tag Info | N-terminal 6xHis-tagged |
| Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |

