Product Details
| Description |
Recombinant Mouse Uroplakin-2 (Upk2) is a partial length protein expressed with N-terminal 6xHis-GST-tagged in the E.coli. Its expression region corresponds to 85-184aa of mouse Upk2 protein. This protein underwent validation via the LC-MS/MS analysis based on the SEQUEST from database of E.coli host and target protein. Its purity was determined by SDS-PAGE and reached up to 90%. It is presented the mass molecule around 40 kDa visualized on the gel. This recombinant Upk2 protein may be used to synthesize antibodies against Upk2 or on the studies of Upk2-associated signal transduction.
Upk2, a component of the asymmetric unit membrane (AUM), is a highly specialized biomembrane elaborated by terminally differentiated urothelial cells and belongs to Uroplakin-2 family. This protein may play an important role in regulating the assembly of the AUM. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | Upk2 |
| Research Area | Signal Transduction |
| Alternative Names | Upk2; Uroplakin-2; UP2; Uroplakin II; UPII |
| Species | Mus musculus (Mouse) |
| Source | E.coli |
| Expression Region | 85-184aa |
| Target Protein Sequence | ELVSVVDSGSGYTVTRLSAYQVTNLTPGTKYYISYRVQKGTSTESSPETPMSTLPRKNMESIGLGMARTGGMVVITVLLSVAMFLLVVGLIVALHWDARK Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 40.8 kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info | N-terminal 6xHis-GST-tagged |
| Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |