Product Details
| Description |
Recombinant Neosartorya fumigata Hydrophobin (rodA) with an N-terminal 6xHis-B2M-tag is a full-length of mature protein expressed in E.coli. The sequence used to prepare this recombinant RodA protein corresponds to residues Leu19-Leu159 of Neosartorya fumigata RodA. Its purity is greater than 85% as determined by SDS-PAGE. A molecular mass band of approximately 30 kDa was visualized on the reducing SDS-PAGE gel. Applied for specific antibody synthesis, this recombinant rodA protein also may be used on Aspergillus fumigatus-related studies. RodA is one of Neosartorya fumigata/Aspergillus fumigatus-expressed hydrophobins, which self-assemble spontaneously into the amphipathic layer at the hydrophilic-hydrophobic interfaces facilitating and supporting the fungal lifecycle at air-water and water-environmental interfaces. As the only needed hydrophobin in A. fumigatus, rodA determines the structure, permeability, hydrophobicity, and immunological inertia of the cell wall surface in con...Read more
|
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Target Names | rodA |
| Research Area | Others |
| Alternative Names | rodA; hyp1; AFUA_5G09580; Hydrophobin; Rodlet protein |
| Species | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
| Source | E.coli |
| Expression Region | 19-159aa |
| Target Protein Sequence | LPQHDVNAAGNGVGNKGNANVRFPVPDDITVKQATEKCGDQAQLSCCNKATYAGDVTDIDEGILAGTLKNLIGGGSGTEGLGLFNQCSKLDLQIPVIGIPIQALVNQKCKQNIACCQNSPSDASGSLIGLGLPCIALGSIL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 28.3 kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info | N-terminal 6xHis-B2M-tagged |
| Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |

