18 years of successful growth

Recombinant Saccharomyces cerevisiae Exopolyphosphatase(PPX1)

Product Details

Description
E.coli-expressed Recombinant Saccharomyces cerevisiae Exopolyphosphatase (PPX1) is a full-length protein carrying an N-terminal 6xHis-tag. It contains 397 amino acids and has a calculated molecular mass of 49.1 kDa. Its purity was determined by SDS-PAGE and reached up to 90%. The purified PPX1 migrated on the SDS–PAGE at a molecular weight of about 50 kDa. It was also identified and quantified using LC-MS/MS. This recombinant PPX1 protein may be used to immunize animals to produce specific antibodies or in the studies of PPX1-participating inorganic polyphosphate hydrolysis. In-stock PPX1 proteins are available. Exopolyphosphatase PPX1 is a phosphatase enzyme that catalyzes the hydrolysis of inorganic polyphosphate (polyP) and contributes to the maintenance of the polyP dynamic balance in the cells. The polyP is believed to exert a regulatory role in the transition to bacterial dormancy. Seema M. Thayil etc. demonstrated that PPX1 is required for M. tuberculosis (Mtb) growth and persis...Read more
Purity Greater than 90% as determined by SDS-PAGE.
Target Names PPX1
Research Area Others
Alternative Names PPX1; YHR201C; Exopolyphosphatase; ExopolyPase; EC 3.6.1.11; Metaphosphatase
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Source E.coli
Expression Region 1-397aa
Target Protein Sequence MSPLRKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 49.1kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.
Download X-Ray Brochures